Pfam domain
Pfam family: RapA_C (PF12137.7)
Uniprot AC: P60240
RecName: RNA polymerase-associated protein RapA
Begin-End: 605-962
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRTIYDSVYNDLINYLASPDQTEGFD
DLIKNCREQHEALKAQLEQGRDRLLEIHSNGGEKAQALAESIEEQDDDTNLIAFAMNLFD
IIGINQDDRGDNMIVLTPSDHMLVPDFPGLSEDGITITFDREVALAREDAQFITWEHPLI
RNGLDLILSGDTGSSTISLLKNKALPVGTLLVELIYVVEAQAPKQLQLNRFLPPTPVRML
LDKNGNNLAAQVEFETFNRQLNAVNRHTGSKLVNAVQQDVHAILQLGEAQIEKSARALID
AARNEADEKLSAELSRLEALRAVNPNIRDDELTAIESNRQQVMESLDQAGWRLDALRL
Structures of the domain P60240 605-962
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s20 X-ray 4.7 K 605-962 None
4s20 X-ray 4.7 L 605-962 None


© NPIDB team 2003 - 2019

text