Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1055-1131
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKV
LLKELQSLCLNVEVLSS
Structures of the domain P60281 1055-1131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 C 1055-1129 None
5vi5 X-ray 3.2 C 1055-1129 None


© NPIDB team 2003 - 2019

text