Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 429-497
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
QFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLI
GSLSVYARV
Structures of the domain P60281 429-497
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 C 429-497 None
6ccv X-ray 3.05 C 429-497 None
6vvt X-ray 2.9 C 429-497 None
5vi5 X-ray 3.2 C 429-497  L-Bb 
6cce X-ray 3.05 C 429-497 None
5vi8 X-ray 2.76 C 429-497 None
5tw1 X-ray 2.76 C 429-497 None
6vvs X-ray 3.11 C 429-497 None


© NPIDB team 2003 - 2021

text