Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 429-497
Organism: Mycobacterium smegmatis
Interaction Mode:  L-Bb 

Sequence:
QFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLI
GSLSVYARV
Structures of the domain P60281 429-497
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 C 429-497 None
5vi5 X-ray 3.2 C 429-497  L-Bb 


© NPIDB team 2003 - 2019

text