Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.17)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 43-416
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEVLAELSPIEDFSGSMSLSFSDPR
FDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIINGT
ERVVVSQLVRSPGVYFDETIDKSTEKTLHSVKVIPGRGAWLEFDVDKRDTVGVRIDRKRR
QPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDTTSGTDEALLDIYRKLRPGEPPTKES
AQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGKPITSSTLTEEDVVATIEYLVRLHEG
QTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDVEA
ITPQTLINIRPVVA
Structures of the domain P60281 43-416
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 C 43-416 None
6ccv X-ray 3.05 C 43-416 None
6vvt X-ray 2.9 C 43-416 None
5vi5 X-ray 3.2 C 43-416 None
6cce X-ray 3.05 C 43-416 None
5vi8 X-ray 2.76 C 43-416 None
5tw1 X-ray 2.76 C 43-416 None
6vvs X-ray 3.11 C 43-416 None
6vvv X-ray 3.2 C 150-416 None


© NPIDB team 2003 - 2021

text