Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.27)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 634-1053
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
VADKTGVIEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVI
ADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDT
KLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLR
AIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDG
DKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKA
GWNIDVAAGVPDWASKLPEELYSAPADSTVATPVFDGAQEGELAGLLGSTLPNRDGEVMV
DADGKSTLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQ
Structures of the domain P60281 634-1053
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 C 634-1053 None
5vi5 X-ray 3.2 C 634-1053 None


© NPIDB team 2003 - 2019

text