Pfam domain
Pfam family: TruB_C_2 (PF16198.4)
Uniprot AC: P60340
RecName: tRNA pseudouridine synthase B
Begin-End: 181-249
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHLRELVEQAEQQDIPAAELLDPL
LMPMDSPAS
Structures of the domain P60340 181-249
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zl3 X-ray 2.8 A 181-247 None
1k8w X-ray 1.85 A 181-247 None


© NPIDB team 2003 - 2019

text