Pfam domain
Pfam family: Ribosomal_L2_C (PF03947.17)
Uniprot AC: P60422
RecName: 50S ribosomal protein L2
Begin-End: 211-249
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ARWRGVRPTVRGTAMNPVDHPHGGGEGRNFGKHPVTPWG
Structures of the domain P60422 211-249
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c4h X-ray 3.1 C 211-249 None


© NPIDB team 2003 - 2019

text