Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P60422
RecName: 50S ribosomal protein L2
Begin-End: 42-118
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRNNNGRITTRHIGGGHKQAYRIVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGER
RYILAPKGLKAGDQIQS
Structures of the domain P60422 42-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 C 42-117 None
5aka X-ray 5.7 C 41-116 None
3j8g X-ray 5 C 41-116 None
5gae X-ray 3.33 C 44-117 None
5gah X-ray 3.8 C 42-117 None
5gad X-ray 3.7 C 44-117 None
4csu X-ray 5.5 C 41-116 None
5gaf X-ray 4.3 C 44-117 None
5ady X-ray 4.5 C 41-116 None
4uy8 X-ray 3.8 C 41-116 None
2rdo X-ray 9.1 C 41-116 None
3j5l X-ray 6.6 C 41-116 None
3bbx X-ray 10 C 41-116 None
2j28 X-ray 8 C 41-116 None
3j7z X-ray 3.9 C 41-116 None


© NPIDB team 2003 - 2019

text