Pfam domain
Pfam family: Ribosomal_L2_C (PF03947.17)
Uniprot AC: P60430
RecName: 50S ribosomal protein L2
Begin-End: 125-251
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
KVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGEVRMI
LSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRP
SPMSPWG
Structures of the domain P60430 125-251
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 A 125-251 None
5nrg X-ray 3.44 A 125-251 None
4wce X-ray 3.53 A 125-251 None
5hl7 X-ray 3.55 A 125-251 None
4wfb X-ray 3.43 A 125-251 None
4wf9 X-ray 3.43 A 125-251 None
4wfa X-ray 3.39 A 125-251 None


© NPIDB team 2003 - 2019

text