Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P60430
RecName: 50S ribosomal protein L2
Begin-End: 42-118
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
GRNNQGKLTVRHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEK
RYIIAPKGLEVGQIVES
Structures of the domain P60430 42-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 A 42-118 None
5nrg X-ray 3.44 A 42-118 None
4wce X-ray 3.53 A 42-118 None
5hl7 X-ray 3.55 A 42-118 None
4wfb X-ray 3.43 A 42-118 None
4wf9 X-ray 3.43 A 42-118 None
4wfa X-ray 3.39 A 42-118 None


© NPIDB team 2003 - 2019

text