Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P60438
RecName: 50S ribosomal protein L3
Begin-End: 118-164
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAGQ
Structures of the domain P60438 118-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c4h X-ray 3.1 D 118-164 None


© NPIDB team 2003 - 2019

text