Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P60438
RecName: 50S ribosomal protein L3
Begin-End: 4-185
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LVGKKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKDLANDGYRAIQVTTGAKKANRVTKP
EAGHFAKAGVEAGRGLWEFRLAEGEEFTVGQSISVELFADVKKVDVTGTSKGKGFAGTVK
RWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAGQMGNERVTVQSLDVVRVDAE
RN
Structures of the domain P60438 4-185
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 D 27-182 None
5aka X-ray 5.7 D 27-182 None
3j8g X-ray 5 D 27-182 None
5gae X-ray 3.33 D 27-182 None
5gah X-ray 3.8 D 27-182 None
5gad X-ray 3.7 D 27-182 None
4csu X-ray 5.5 D 27-182 None
5gaf X-ray 4.3 D 27-182 None
5ady X-ray 4.5 D 27-182 None
4uy8 X-ray 3.8 D 27-182 None
2rdo X-ray 9.1 D 27-182 None
3j5l X-ray 6.6 D 27-182 None
3bbx X-ray 10 D 27-182 None
2j28 X-ray 8 D 27-182 None
3j7z X-ray 3.9 D 27-182 None


© NPIDB team 2003 - 2019

text