Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: P60624
RecName: 50S ribosomal protein L24
Begin-End: 39-103
Organism: Escherichia coli
Interaction Mode:   

Sequence:
INLVKKHQKPVPALNQPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKS
NSETI
Structures of the domain P60624 39-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 V 39-103 None
5aka X-ray 5.7 U 38-102 None
3j8g X-ray 5 U 38-102 None
5gae X-ray 3.33 V 39-103 None
5gah X-ray 3.8 V 39-103 None
5gad X-ray 3.7 V 39-103 None
4csu X-ray 5.5 U 36-100 None
3j45 X-ray 9.5 U 38-102 None
5gaf X-ray 4.3 V 39-103 None
5ady X-ray 4.5 U 38-102 None
4uy8 X-ray 3.8 U 38-102 None
2rdo X-ray 9.1 U 38-102 None
3j5l X-ray 6.6 U 38-102 None
3bbx X-ray 10 U 38-102 None
3j46 X-ray 10.1 U 38-102 None
2j28 X-ray 8 U 38-102 None
3j7z X-ray 3.9 U 38-102 None


© NPIDB team 2003 - 2019

text