Pfam domain
Pfam family: EFG_C (PF00679.23)
Uniprot AC: P60785
RecName: Elongation factor 4
Begin-End: 398-486
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ELREPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDR
LKSTSRGYASLDYNFKRFQASDMVRVDVL
Structures of the domain P60785 398-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3deg X-ray 10.9 C 399-482 None


© NPIDB team 2003 - 2019

text