Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: P61010
RecName: Signal recognition particle 54 kDa protein
Begin-End: 326-431
Organism: Canis lupus familiaris
Interaction Mode:   

Sequence:
QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQ
ELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMV
Structures of the domain P61010 326-431
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2go5 X-ray 7.4 W 326-431 None
4ue5 X-ray 9 D 326-431 None


© NPIDB team 2003 - 2019

text