Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: P61218
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC2
Begin-End: 51-104
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPI
Structures of the domain P61218 51-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 F 51-104 None
5iya X-ray 5.4 F 51-104 None
5iy8 X-ray 7.9 F 51-104 None
5iyd X-ray 3.9 F 51-104 None
5iy6 X-ray 7.2 F 51-104 None
5iyc X-ray 3.9 F 51-104 None
5iy9 X-ray 6.3 F 51-104 None
5iyb X-ray 3.9 F 51-104 None


© NPIDB team 2003 - 2019

text