Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: P61247
RecName: 40S ribosomal protein S3a
Begin-End: 21-221
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVA
FRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCV
GFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA
CQSIYPLHDVFVRKVKMLKKP
Structures of the domain P61247 21-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 B 21-221 None
5flx X-ray 3.9 B 4-221 None
5oa3 X-ray 4.3 B 2-221 None


© NPIDB team 2003 - 2020

text