Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P61830
RecName: Histone H3
Begin-End: 39-132
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVE
AYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLR
Structures of the domain P61830 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jjn X-ray 3.09 E 39-131  H-Bb H-Mj S-Bb L-Bb 
4jjn X-ray 3.09 A 38-131  H-Bb H-Mj S-Bb L-Bb 
1id3 X-ray 3.1 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
1id3 X-ray 3.1 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4kud X-ray 3.2 E 36-131  H-Bb H-Mj S-Bb L-Bb 
4kud X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text