Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P61875
RecName: DNA polymerase
Begin-End: 20-131
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
KKENGKFKIEHDRTFRPYIYALLRDDSKIEEVKKITGERHGKIVRIVDVEKVEKKFLGKP
ITVWKLYLEHPQDVPTIREKVREHPAVVDIFEYDIPFAKRYLIDKGLIPMEG
Structures of the domain P61875 20-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ail X-ray 2.9 C 21-129 None


© NPIDB team 2003 - 2020

text