Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: P61875
RecName: DNA polymerase
Begin-End: 344-749
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
VSRSSTGNLVEWFLLRKAYERNEVAPNKPSEEEYQRRLRESYTGGFVKEPEKGLWENIVY
LDFRALYPSIIITHNVSPDTLNLEGCKNYDIAPQVGHKFCKDIPGFIPSLLGHLLEERQK
IKTKMKETQDPIEKILLDYRQKAIKLLANSFYGYYGYAKARWYCKECAESVTAWGRKYIE
LVWKELEEKFGFKVLYIDTDGLYATIPGGESEEIKKKALEFVKYINSKLPGLLELEYEGF
YKRGFFVTKKRYAVIDEEGKVITRGLEIVRRDWSEIAKETQARVLETILKHGDVEEAVRI
VKEVIQKLANYEIPPEKLAIYEQITRPLHEYKAIGPHVAVAKKLAAKGVKIKPGMVIGYI
VLRGDGPISNRAILAEEYDPKKHKYDAEYYIENQVLPAVLRILEGF
Structures of the domain P61875 344-749
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ail X-ray 2.9 C 349-747 None


© NPIDB team 2003 - 2019

text