Pfam domain
Pfam family: Rad60-SLD (PF11976.7)
Uniprot AC: P61957
RecName: Small ubiquitin-related modifier 2
Begin-End: 18-88
Organism: Mus musculus
Interaction Mode:   

Sequence:
INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLE
MEDEDTIDVFQ
Structures of the domain P61957 18-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tvp X-ray 2.4 Q 18-86 None


© NPIDB team 2003 - 2019

text