Pfam domain
Pfam family: WD40 (PF00400.34)
Uniprot AC: P61964
RecName: WD repeat-containing protein 5
Begin-End: 35-72
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIW
Structures of the domain P61964 35-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kix X-ray 4.1 R 36-72 None
6pww X-ray 4.4 B 35-72 None
6kiu X-ray 3.2 R 36-72 None
6pwv X-ray 6.2 B 35-72 None
6kiz X-ray 4.5 R 36-72 None
6kiw X-ray 4 R 36-72 None
6kiv X-ray 4 R 36-72 None


© NPIDB team 2003 - 2021

text