Pfam domain
Pfam family: TFIIB (PF00382.18)
Uniprot AC: P61999
RecName: Transcription initiation factor IIB
Begin-End: 116-186
Organism: Pyrococcus woesei
Interaction Mode:  H-Bb 

Sequence:
LDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEI
ADIARVDKKEI
Structures of the domain P61999 116-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ais X-ray 2.1 B 1117-1186 None
1d3u X-ray 2.4 B 1117-1186  H-Bb 


© NPIDB team 2003 - 2021

text