Pfam domain
Pfam family: TFIIB (PF00382.18)
Uniprot AC: P61999
RecName: Transcription initiation factor IIB
Begin-End: 212-282
Organism: Pyrococcus woesei
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VNKFADELGLSEKVRRRAIEILDEAYKRGLTSGKSPAGLVAAALYIASLLEGEKRTQREV
AEVARVTEVTV
Structures of the domain P61999 212-282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ais X-ray 2.1 B 1212-1282  H-Bb L-Bb 
1d3u X-ray 2.4 B 1212-1282  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text