Pfam domain
Pfam family: TBP (PF00352.20)
Uniprot AC: P62001
RecName: TATA-box-binding protein
Begin-End: 8-90
Organism: Pyrococcus woesei
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb 

Sequence:
KLRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHLDDPKVALLIFSSGKLVV
TGAKSVQDIERAVAKLAQKLKSI
Structures of the domain P62001 8-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ais X-ray 2.1 A 9-89 None
1d3u X-ray 2.4 A 9-89  S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2020

text