Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: P62263
RecName: 40S ribosomal protein S14
Begin-End: 29-147
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKEL
GITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRR
Structures of the domain P62263 29-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 O 29-147 None
5flx X-ray 3.9 O 29-147 None
5oa3 X-ray 4.3 O 29-147 None


© NPIDB team 2003 - 2020

text