Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: P62266
RecName: 40S ribosomal protein S23
Begin-End: 29-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPND
GCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKER
Structures of the domain P62266 29-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cxh X-ray 8.9 X 57-140 None
4cxg X-ray 8.7 X 57-140 None
5a2q X-ray 3.9 X 30-142 None
5flx X-ray 3.9 X 30-140 None
5oa3 X-ray 4.3 X 30-142 None


© NPIDB team 2003 - 2020

text