Pfam domain
Pfam family: Ribosomal_S13_N (PF08069.11)
Uniprot AC: P62277
RecName: 40S ribosomal protein S13
Begin-End: 2-60
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGV
Structures of the domain P62277 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 N 2-60 None
5flx X-ray 3.9 N 2-60 None
5oa3 X-ray 4.3 N 2-60 None


© NPIDB team 2003 - 2020

text