Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: P62277
RecName: 40S ribosomal protein S13
Begin-End: 70-148
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYY
KTKRVLPPNWKYESSTASA
Structures of the domain P62277 70-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 N 74-146 None
5flx X-ray 3.9 N 74-146 None
5oa3 X-ray 4.3 N 74-146 None


© NPIDB team 2003 - 2020

text