Pfam domain
Pfam family: Ribosomal_S17_N (PF16205.4)
Uniprot AC: P62280
RecName: 40S ribosomal protein S11
Begin-End: 5-73
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTG
NVSIRGRIL
Structures of the domain P62280 5-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 L 5-73 None
5flx X-ray 3.9 L 6-73 None
5oa3 X-ray 4.3 L 5-73 None


© NPIDB team 2003 - 2020

text