Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: P62280
RecName: 40S ribosomal protein S11
Begin-End: 75-144
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPL
SKTVRFNVLK
Structures of the domain P62280 75-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 L 75-144 None
5flx X-ray 3.9 L 75-144 None
5oa3 X-ray 4.3 L 75-144 None


© NPIDB team 2003 - 2020

text