Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62304
RecName: Small nuclear ribonucleoprotein E
Begin-End: 23-89
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGD
NITLLQS
Structures of the domain P62304 23-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 E 24-88 None
3pgw X-ray 4.4 H 24-88 None
4pjo X-ray 3.3 s 24-88 None
4pjo X-ray 3.3 S 24-88 None
4pjo X-ray 3.3 e 24-88 None
4pjo X-ray 3.3 E 24-88 None
3cw1 X-ray 5.49 E 24-88 None
3cw1 X-ray 5.49 W 224-288 None
3cw1 X-ray 5.49 X 424-488 None
3cw1 X-ray 5.49 Y 624-688 None
3jcr X-ray 7 s 24-88 None
3jcr X-ray 7 S 24-88 None
5o9z X-ray 4.5 U 14-88 None
5o9z X-ray 4.5 j 24-88 None
5o9z X-ray 4.5 c 24-88 None


© NPIDB team 2003 - 2019

text