Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62306
RecName: Small nuclear ribonucleoprotein F
Begin-End: 9-74
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNN
VLYIRG
Structures of the domain P62306 9-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 F 10-72 None
3pgw X-ray 4.4 I 10-72 None
4pjo X-ray 3.3 t 10-72 None
4pjo X-ray 3.3 T 10-72 None
4pjo X-ray 3.3 f 10-72 None
4pjo X-ray 3.3 F 9-71 None
3cw1 X-ray 5.49 F 10-72 None
3cw1 X-ray 5.49 Z 210-272 None
3cw1 X-ray 5.49 1 410-472 None
3cw1 X-ray 5.49 2 610-672 None
3jcr X-ray 7 t 10-72 None
3jcr X-ray 7 T 10-72 None
5o9z X-ray 4.5 T 10-72 None
5o9z X-ray 4.5 i 10-72 None
5o9z X-ray 4.5 b 120-182 None


© NPIDB team 2003 - 2019

text