Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62308
RecName: Small nuclear ribonucleoprotein G
Begin-End: 7-72
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNS
IIMLEA
Structures of the domain P62308 7-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 G 8-71 None
3pgw X-ray 4.4 J 8-71 None
4pjo X-ray 3.3 u 8-71 None
4pjo X-ray 3.3 U 8-69 None
4pjo X-ray 3.3 g 8-71 None
4pjo X-ray 3.3 G 9-72 None
3cw1 X-ray 5.49 G 8-71 None
3cw1 X-ray 5.49 3 208-271 None
3cw1 X-ray 5.49 4 408-471 None
3cw1 X-ray 5.49 5 608-671 None
3jcr X-ray 7 u 8-71 None
3jcr X-ray 7 U 8-71 None
5o9z X-ray 4.5 V 8-71 None
5o9z X-ray 4.5 k 8-71 None
5o9z X-ray 4.5 d 8-71 None


© NPIDB team 2003 - 2019

text