Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62310
RecName: U6 snRNA-associated Sm-like protein LSm3
Begin-End: 19-97
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKST
KRNIPMLFVRGDGVVLVAP
Structures of the domain P62310 19-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 3 21-96 None
5o9z X-ray 4.5 p 21-96 None


© NPIDB team 2003 - 2019

text