Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62312
RecName: U6 snRNA-associated Sm-like protein LSm6
Begin-End: 10-75
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNN
VLYIST
Structures of the domain P62312 10-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 6 10-74 None
5o9z X-ray 4.5 s 10-74 None


© NPIDB team 2003 - 2019

text