Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62314
RecName: Small nuclear ribonucleoprotein Sm D1
Begin-End: 5-70
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNN
IRYFIL
Structures of the domain P62314 5-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 X 5-69 None
3pgw X-ray 4.4 U 5-69 None
4pjo X-ray 3.3 q 5-69 None
4pjo X-ray 3.3 Q 3-67 None
4pjo X-ray 3.3 c 5-69 None
4pjo X-ray 3.3 C 5-69 None
3cw1 X-ray 5.49 B 5-69 None
3cw1 X-ray 5.49 M 205-269 None
3cw1 X-ray 5.49 N 405-469 None
3cw1 X-ray 5.49 O 605-669 None
3jcr X-ray 7 p 5-69 None
3jcr X-ray 7 P 5-68 None
5o9z X-ray 4.5 Z 6-70 None
5o9z X-ray 4.5 n 82-69 None
5o9z X-ray 4.5 g 5-69 None


© NPIDB team 2003 - 2019

text