Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62316
RecName: Small nuclear ribonucleoprotein Sm D2
Begin-End: 33-111
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNK
DRYISKMFLRGDSVIVVLR
Structures of the domain P62316 33-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 Y 37-109 None
3pgw X-ray 4.4 V 37-109 None
4pjo X-ray 3.3 r 37-109 None
4pjo X-ray 3.3 R 37-108 None
4pjo X-ray 3.3 d 37-109 None
4pjo X-ray 3.3 D 40-113 None
3cw1 X-ray 5.49 C 37-109 None
3cw1 X-ray 5.49 P 237-309 None
3cw1 X-ray 5.49 Q 437-509 None
3cw1 X-ray 5.49 R 637-709 None
3jcr X-ray 7 q 37-109 None
3jcr X-ray 7 Q 37-109 None
5o9z X-ray 4.5 S 26-109 None
5o9z X-ray 4.5 h 47-104 None
5o9z X-ray 4.5 a 37-109 None


© NPIDB team 2003 - 2019

text