Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P62318
RecName: Small nuclear ribonucleoprotein Sm D3
Begin-End: 8-73
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSK
IRFLIL
Structures of the domain P62318 8-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 Z 9-72 None
3pgw X-ray 4.4 W 9-72 None
4pjo X-ray 3.3 o 9-72 None
4pjo X-ray 3.3 O 10-73 None
4pjo X-ray 3.3 a 9-72 None
4pjo X-ray 3.3 A 10-73 None
3cw1 X-ray 5.49 D 9-72 None
3cw1 X-ray 5.49 S 209-272 None
3cw1 X-ray 5.49 T 409-472 None
3cw1 X-ray 5.49 U 609-672 None
3jcr X-ray 7 r 9-72 None
3jcr X-ray 7 R 9-72 None
5o9z X-ray 4.5 W 8-68 None
5o9z X-ray 4.5 l 9-72 None
5o9z X-ray 4.5 e 9-72 None


© NPIDB team 2003 - 2019

text