Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: P62374
RecName: Histidine--tRNA ligase
Begin-End: 330-419
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDEL
RAGEVTLKRLATGEQVRLSREEVPGYLLQA
Structures of the domain P62374 330-419
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4rdx X-ray 2.55 A 331-417 None


© NPIDB team 2003 - 2019

text