Pfam domain
Pfam family: Ribosomal_L5_C (PF00673.20)
Uniprot AC: P62399
RecName: 50S ribosomal protein L5
Begin-End: 84-177
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDY
DKVDRVRGLDITITTTAKSDEEGRALLAAFDFPF
Structures of the domain P62399 84-177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 F 84-177 None
5aka X-ray 5.7 F 83-176 None
3j5s X-ray 7.5 G 83-176 None
3j8g X-ray 5 F 83-176 None
5gae X-ray 3.33 F 84-177 None
5gah X-ray 3.8 F 84-177 None
5gad X-ray 3.7 F 84-177 None
4csu X-ray 5.5 F 83-176 None
5gaf X-ray 4.3 F 84-177 None
5ady X-ray 4.5 F 83-176 None
4uy8 X-ray 3.8 F 83-176 None
2rdo X-ray 9.1 F 83-176 None
3j5l X-ray 6.6 F 83-176 None
3bbx X-ray 10 F 83-176 None
2j28 X-ray 8 F 83-176 None
3j7z X-ray 3.9 F 83-176 None


© NPIDB team 2003 - 2019

text