Pfam domain
Pfam family: S1 (PF00575.22)
Uniprot AC: P62487
RecName: DNA-directed RNA polymerase II subunit RPB7
Begin-End: 78-161
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVI
QQDDEIRLKIVGTRVDKNDIFAIG
Structures of the domain P62487 78-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 G 78-160 None
5iya X-ray 5.4 G 78-160 None
5iy8 X-ray 7.9 G 78-160 None
5iyd X-ray 3.9 G 78-160 None
5iy6 X-ray 7.2 G 78-160 None
5iyc X-ray 3.9 G 78-160 None
5iy9 X-ray 6.3 G 78-160 None
5iyb X-ray 3.9 G 78-160 None


© NPIDB team 2003 - 2019

text