Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.16)
Uniprot AC: P62487
RecName: DNA-directed RNA polymerase II subunit RPB7
Begin-End: 8-77
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVL
YPVKYKAIVF
Structures of the domain P62487 8-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 G 11-77 None
5iya X-ray 5.4 G 11-77 None
5iy8 X-ray 7.9 G 11-77 None
5iyd X-ray 3.9 G 11-77 None
5iy6 X-ray 7.2 G 11-77 None
5iyc X-ray 3.9 G 11-77 None
5iy9 X-ray 6.3 G 11-77 None
5iyb X-ray 3.9 G 11-77 None


© NPIDB team 2003 - 2019

text