Pfam domain
Pfam family: eRF1_2 (PF03464.14)
Uniprot AC: P62495
RecName: Eukaryotic peptide chain release factor subunit 1
Begin-End: 145-277
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRK
VAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGF
NQAIELSTEVLSN
Structures of the domain P62495 145-277
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5n X-ray 9 A 145-277 None
4d61 X-ray 9 h 144-277 None
5a8l X-ray 3.8 Q 145-277 None
3j5y X-ray 9.7 A 145-277 None


© NPIDB team 2003 - 2019

text