Pfam domain
Pfam family: eRF1_1 (PF03463.14)
Uniprot AC: P62495
RecName: Eukaryotic peptide chain release factor subunit 1
Begin-End: 18-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITS
VQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALT
ALL
Structures of the domain P62495 18-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5n X-ray 9 A 18-138 None
4d61 X-ray 9 h 17-137 None
5a8l X-ray 3.8 Q 18-138 None
3j5y X-ray 9.7 A 18-138 None


© NPIDB team 2003 - 2019

text