Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P62664
RecName: 30S ribosomal protein S4
Begin-End: 3-98
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQ
KLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLE
Structures of the domain P62664 3-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kvb X-ray 4.2 D 3-98 None


© NPIDB team 2003 - 2019

text