Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: P62666
RecName: 30S ribosomal protein S6
Begin-End: 3-92
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLW
YQVEMPEDRVNDLARELRIRDNVRRVMVVK
Structures of the domain P62666 3-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kvb X-ray 4.2 F 3-92 None


© NPIDB team 2003 - 2019

text