Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: P62669
RecName: 30S ribosomal protein S9
Begin-End: 8-128
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRG
GGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSK
R
Structures of the domain P62669 8-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i94 X-ray 3.2 I 8-128 None
1i96 X-ray 4.2 I 8-128 None
2r1g X-ray 12.5 G 8-128 None
3t1h X-ray 3.11 I 8-128 None
3t1y X-ray 2.8 I 8-128 None
4kvb X-ray 4.2 I 8-128 None
2vqe X-ray 2.5 I 8-128 None


© NPIDB team 2003 - 2019

text