Pfam domain
Pfam family: KOW (PF00467.28)
Uniprot AC: P62701
RecName: 40S ribosomal protein S4, X isoform
Begin-End: 177-211
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK
Structures of the domain P62701 177-211
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 E 178-211 None
5oa3 X-ray 4.3 E 178-211 None


© NPIDB team 2003 - 2020

text