Pfam domain
Pfam family: 40S_S4_C (PF16121.4)
Uniprot AC: P62701
RecName: 40S ribosomal protein S4, X isoform
Begin-End: 212-259
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAK
Structures of the domain P62701 212-259
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 E 212-259 None
5oa3 X-ray 4.3 E 212-259 None


© NPIDB team 2003 - 2020

text